PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00047.1.g01940.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 490aa    MW: 53600.2 Da    PI: 7.0938
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00047.1.g01940.1.sm.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.54.7e-31100153255
                       G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                   prlrWtp+LH +Fv+ave+LGG+e+AtPk +l++m+v gL++ hvkSHLQ+YR+
  Zjn_sc00047.1.g01940.1.sm.mk 100 PRLRWTPDLHMAFVHAVERLGGQERATPKLVLQMMNVRGLSIGHVKSHLQMYRS 153
                                   8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.2E-2896154IPR009057Homeodomain-like
PROSITE profilePS5129412.25596156IPR017930Myb domain
SuperFamilySSF466891.24E-1399154IPR009057Homeodomain-like
TIGRFAMsTIGR015576.2E-22100155IPR006447Myb domain, plants
PfamPF002491.6E-8101152IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 490 aa     Download sequence    Send to blast
MDHKQVLQVL DDDEEIRSMG NNALDLNVDV VSEEGEVGDD DDEDDGDGGS TTDAAGSRSS  60
SNNSSTNKDS ESKKGCGGEV EGSGEKRVPS VRPYNRSKLP RLRWTPDLHM AFVHAVERLG  120
GQERATPKLV LQMMNVRGLS IGHVKSHLQM YRSKKLDQDG RPRGAVSSVH SPMDFHFMRG  180
ERGFHGLSFL QRAAALSSSG PEHGGFFASR NGGRTNFSRI YGLLQHHRQP QMQSFDFRSS  240
SFRRHERALN QREEVITRKE VFKQPSTSRP QPHHPLAPSP ASISSERRWW PFADAGAAVA  300
GEHTRVDTGQ GANFESSFGS NSRPLSWVVS GDLHLPFRWR PGSGGSHVSN NTAMIRKPSD  360
PVVIDEAPDD AQQLERQEYV EPIRGACRKR PLSEAQDSTA PDLQLSLSHS PTAAVDDAKK  420
RKTAAAAGEQ EVIHSSELSI SLSLWPPAAA SMQLQHPPRE KTRGSSGSGS GEAVLGQSTL  480
DLTMSIRALE
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004951340.11e-166PREDICTED: uncharacterized protein LOC101755438
TrEMBLK3YRR11e-166K3YRR1_SETIT; Uncharacterized protein
STRINGSi016955m1e-166(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP27543686
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.11e-34G2-like family protein